1. Recombinant Proteins
  2. Others
  3. Lipocalin-2/NGAL Protein, Mouse (HEK293, C-His)

Lipocalin-2/NGAL Protein, Mouse (HEK293, C-His)

Cat. No.: HY-P70658A
Handling Instructions Technical Support

Lipocalin-2/NGAL Protein, Mouse (HEK293, His) is an 20-28 kDa NGAL protein with a His-flag, which is expressed in HEK293 cells. NGAL is an antibacterial factor of natural immunity, and an acute-phase protein.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Lipocalin-2/NGAL Protein, Mouse (HEK293, C-His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lipocalin-2/NGAL Protein, Mouse (HEK293, His) is an 20-28 kDa NGAL protein with a His-flag, which is expressed in HEK293 cells. NGAL is an antibacterial factor of natural immunity, and an acute-phase protein[1].

Background

NGAL is a 25 kDa protein belonging to the lipocalin superfamily, which is first known as an antibacterial factor of natural immunity, and an acute-phase protein.
NGAL is initially found in activated neutrophils, and other cells, like kidney tubular cells, may produce NGAL in response to various insults.ipocalin-2 (LCN2/NGAL) has been implicated in a variety of processes including cell differentiation, proliferation, survival, and morphogenesis.NGAL has anti-tumoral and anti-metastatic effects in neoplasias, for example, the colon, ovary and pancreas[1].

Biological Activity

Measured by its ability to bind Iron(III) dihydroxybenzoic acid [Fe(DHBA)3] that Incubate at room temperature for 10 minutes. The binding of Fe(DHBA)3 results in the quenching of Trp fluorescence in NGAL. ≤1.852 μM of Fe(DHBA)3 can be bound.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P11672 (Q21-N200)

Gene ID
Molecular Construction
N-term
NGAL (Q21-N200)
Accession # P11672
6*His
C-term
Synonyms
Neutrophil gelatinase-associated lipocalin; NGAL; Lipocalin-2; SV-40-induced 24P3 protein; Siderocalin LCN2; p25; LCN2
AA Sequence

QDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

Molecular Weight

Approximately 20-28 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 8% Trehalose, 2% Glycine, 50 mM NaCl, 0.05% Tween 80, pH 6.5 or PBS, pH 7.4 or 20 mM MES, 150 mM NaCl, pH 5.5, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Lipocalin-2/NGAL Protein, Mouse (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lipocalin-2/NGAL Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P70658A
Quantity:
MCE Japan Authorized Agent: