LMCD1 Protein, Human (His)

The LMCD1 protein is a transcriptional cofactor that regulates GATA6 by blocking its DNA binding, thereby inhibiting transcriptional activation in lung and heart tissues. It inhibits GATA6-mediated transactivation of tissue-specific promoters, which is critical for developmental processes. LMCD1 Protein, Human (His) is the recombinant human-derived LMCD1 protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

LMCD1, a transcriptional cofactor, serves as a regulatory brake on GATA6 function, exerting control by impeding GATA6's DNA-binding capacity and thereby suppressing its transcriptional activation of downstream target genes. Specifically, LMCD1 intervenes to repress GATA6-mediated transactivation of tissue-specific promoters in lung and cardiac tissues, displaying a crucial role in regulating these developmental processes. Additionally, LMCD1 acts as a modulator of DNA-binding by inhibiting GATA4 and GATA1 at the cTNC promoter. The intricate interplay between LMCD1 and GATA transcription factors underscores its significance in finely tuning gene expression, particularly in the context of cardiac hypertrophy, where LMCD1's activation of the calcineurin/nuclear factor of activated T-cells signaling pathway is implicated. LMCD1's molecular interactions extend to GATA1, GATA4, and beta-dystroglycan, highlighting its multifaceted involvement in transcriptional regulation and cellular processes.

Human

E. coli

N-6*His;C-6*His

Q9NZU5-1 (M1-S365)

29995  [NCBI]

MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS

Approximately 45.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.