1. Recombinant Proteins
  2. Others
  3. LolA Protein, E.coli (P.pastoris, His)

LolA Protein translocates lipoproteins from bacterial inner to outer membranes, forming a complex dependent on the absence of aspartate after the N-terminal cysteine. Aspartate signals lipoproteins to stay in the inner membrane. LolA, as a monomer, efficiently moves lipoproteins between bacterial membrane compartments. LolA Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived LolA protein, expressed by P. pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LolA Protein translocates lipoproteins from bacterial inner to outer membranes, forming a complex dependent on the absence of aspartate after the N-terminal cysteine. Aspartate signals lipoproteins to stay in the inner membrane. LolA, as a monomer, efficiently moves lipoproteins between bacterial membrane compartments. LolA Protein, E.coli (P.pastoris, His) is the recombinant E. coli-derived LolA protein, expressed by P. pastoris , with N-His labeled tag.

Background

LolA Protein is involved in the translocation of lipoproteins from the inner membrane to the outer membrane in bacterial cells. It forms a complex with lipoproteins, but this interaction is contingent upon the absence of aspartate immediately following the N-terminal cysteine in the lipoprotein sequence. The presence of aspartate serves as a targeting signal, indicating that the lipoprotein should remain in the inner membrane. LolA functions as a monomer in facilitating the efficient movement of lipoproteins between bacterial membrane compartments.

Species

E.coli

Source

P. pastoris

Tag

N-His

Accession

A7ZYJ5 (D22-K203)

Gene ID

/

Molecular Construction
N-term
His
LolA (D22-K203)
Accession # A7ZYJ5
C-term
Synonyms
lolA; Outer-membrane lipoprotein carrier protein
AA Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

Molecular Weight

Approximately 22.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LolA Protein, E.coli (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LolA Protein, E.coli (P.pastoris, His)
Cat. No.:
HY-P71812
Quantity:
MCE Japan Authorized Agent: