LRG1 Protein, Human (HEK293, His)

LRG1 Protein, Human (HEK293, His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRG1 Protein, Human (HEK293, His) is 312 a.a., with molecular weight of 40-60 kDa.

Measured by its binding ability in a functional ELISA. Immobilized human Cytochrome c, at 1 μg/mL (100 μL/well) can bind Biotinylated Human LRG1 protein. The ED₅₀ for this effect is 14.13-75.59 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized human Cytochrome c, at 1 μg/mL (100 μL/well) can bind Biotinylated Human LRG1 protein. The ED₅₀ for this effect is 75.59 ng/mL.

Human

HEK293

C-6*His

AAH34389.1  (V36-Q347)

116844  [NCBI]

VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Approximately 40-60 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 20 mM NaCl, pH 7.5 or PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.