LRRC3B Protein, Human (HEK293, His)

LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis^[1][2][3]. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293, with C-6*His labeled tag. The total length of LRRC3B Protein, Human (HEK293, His) is 171 a.a., with molecular weight of ~52.0 kDa.

Leucine-rich repeat-containing protein 3B (LRRC3B) is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers^[1]. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis^[2]. Besides, It's reported that LRRC3B is up-regulated in the virus infected group compared with the control, indicating LRRC3B is involved in immune-related processes that trigger the innate immune response through activation of the IFN signaling pathway^[3].

Human

HEK293

C-6*His

Q96PB8 (C34-Y204)

116135  [NCBI]

CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDY

Approximately 52.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.