1. Recombinant Proteins
  2. Others
  3. LRRC3B Protein, Human (HEK293, His)

LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRRC3B Protein, Human (HEK293, His) is 171 a.a., with molecular weight of ~52.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LRRC3B Protein is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers. But LRRC3B is up-regulated in the virus infected group. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[1][2][3]. LRRC3B Protein, Human (HEK293, His) is the recombinant human-derived LRRC3B protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRRC3B Protein, Human (HEK293, His) is 171 a.a., with molecular weight of ~52.0 kDa.

Background

Leucine-rich repeat-containing protein 3B (LRRC3B) is a leucine-rich repeat-containing transmembrane protein. LRRC3B, a tumor suppressor, is invovled in carcinogenesis, and the expression is down-regulated in gastric, breast, colon, testis, prostate, and brain cancers[1]. LRRC3B is involved in plant and animal immunity, hormone-receptor interactions, cell adhesion, signal transduction, regulation of gene expression, and apoptosis[2]. Besides, It's reported that LRRC3B is up-regulated in the virus infected group compared with the control, indicating LRRC3B is involved in immune-related processes that trigger the innate immune response through activation of the IFN signaling pathway[3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96PB8 (C34-Y204)

Gene ID
Molecular Construction
N-term
LRRC3B (C34-Y204)
Accession # Q96PB8
6*His
C-term
Synonyms
Leucine-Rich Repeat-Containing Protein 3B; Leucine-Rich Repeat Protein LRP15; LRRC3B; LRP15
AA Sequence

CPKGCLCSSSGGLNVTCSNANLKEIPRDLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDLSDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEHAGRPFLNAANDADLCNLPKKTTDY

Molecular Weight

Approximately 52.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LRRC3B Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LRRC3B Protein, Human (HEK293, His)
Cat. No.:
HY-P70894
Quantity:
MCE Japan Authorized Agent: