Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO)

Lymphocyte antigen 6E/LY6E protein is a GPI-anchored cell surface regulator that regulates T cell receptor signaling through interaction with CD3Z/CD247. It limits the entry of human coronaviruses, serves as the primary receptor for syncytin-A, and may modulate nicotinic acetylcholine receptor activity. Lymphocyte antigen 6E/LY6E Protein, Human (His-SUMO) is the recombinant human-derived Lymphocyte antigen 6E/LY6E protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

LY6E, a glycosylphosphatidylinositol (GPI)-anchored cell surface protein, serves as a key regulator of T-lymphocyte proliferation, differentiation, and activation. Functionally, it modulates T-cell receptor (TCR) signaling by interacting with the CD3Z/CD247 component at the plasma membrane, thereby influencing the phosphorylation status of CD3Z/CD247. Additionally, LY6E plays a critical role in restricting the entry of human coronaviruses, including SARS-CoV, MERS-CoV, and SARS-CoV-2, by disrupting spike protein-mediated membrane fusion. Notably, it acts as the primary receptor for syncytin-A (SynA), contributing to placenta formation by facilitating the fusion of syncytiotrophoblast layer I (SynT-I) and ensuring proper morphogenesis of fetal and maternal vasculatures within the placenta. Furthermore, LY6E may function as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In the context of microbial infection, LY6E both facilitates and restricts viral entry, enhancing the fusion process for various viruses, including HIV-1, West Nile virus, dengue virus, and Zika virus, while being dispensable for the paramyxovirus PIV5 that enters at the plasma membrane. Mechanistically, LY6E adopts a microtubule-like organization upon viral infection, contributing to enhanced viral uncoating following endosomal escape.

Human

E. coli

N-His;N-SUMO

Q16553 (L21-S101)

4061  [NCBI]

LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS

Approximately 24.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.