LY6G6D Protein, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of LY6G6D Protein, Human (P.pastoris, His) is 85 a.a., with homodimer molecular weight of 11 & 22 kDa, respectively.

LY6G6D belongs to the leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. LY6G, a small protein attached to cell surfaces via glycosylphosphatidylinositol (GPI) anchor, is used as a marker for granulocyte and myeloid suppressor cell subpopulations in mice. LY6G6D participates in the JAK-STAT5 and RAS-MEK-ERK signaling pathways. LY6G6D is a selectively expressed colorectal cancer antigen that targets therapeutic T-cell responses via T-cell adaptors^[1][2][3][4].

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody , the EC₅₀ is 2.816-9.81 ng/mL.

Human

P. pastoris

N-6*His

O95868 (N20-S104)

58530  [NCBI]

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

11 & 22 kDa in SDS-PAGE may be due to homodimer

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.