1. Recombinant Proteins
  2. Others
  3. LY6G6D Protein, Human (P.pastoris, His)

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of LY6G6D Protein, Human (P.pastoris, His) is 85 a.a., with homodimer molecular weight of 11 & 22 kDa, respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LY6G6D Protein is a leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. LY6G6D Protein is involved in the JAK-STAT5 and RAS-MEK-ERK signaling pathways, and is a selective expression of colorectal cancer antigen. Therapeutic T-cell responses can be targeted through T-cell adaptors. LY6G6D Protein, Human (P.pastoris, His) is the recombinant human-derived LY6G6D protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of LY6G6D Protein, Human (P.pastoris, His) is 85 a.a., with homodimer molecular weight of 11 & 22 kDa, respectively.

Background

LY6G6D belongs to the leukocyte antigen-6 (LY6) gene cluster located in the Major Histocompatibility complex (MHC) Class III region of chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. LY6G, a small protein attached to cell surfaces via glycosylphosphatidylinositol (GPI) anchor, is used as a marker for granulocyte and myeloid suppressor cell subpopulations in mice. LY6G6D participates in the JAK-STAT5 and RAS-MEK-ERK signaling pathways. LY6G6D is a selectively expressed colorectal cancer antigen that targets therapeutic T-cell responses via T-cell adaptors[1][2][3][4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody , the EC50 is 2.816-9.81 ng/mL.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

O95868 (N20-S104)

Gene ID
Molecular Construction
N-term
6*His
LY6G6D (N20-S104)
Accession # O95868
C-term
Synonyms
LY66D_HUMAN; Ly6g6d; Lymphocyte antigen 6 complex locus protein G6d; Megakaryocyte-enhanced gene transcript 1 protein; Protein Ly6-D
AA Sequence

NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Molecular Weight

11 & 22 kDa in SDS-PAGE may be due to homodimer

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LY6G6D Protein, Human (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LY6G6D Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71751
Quantity:
MCE Japan Authorized Agent: