Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)

LY6E is a GPI-anchored cell surface protein that regulates T lymphocyte function by binding to CD3Z/CD247, affecting proliferation, differentiation and activation.It modulates T cell receptor signaling and exhibits antiviral activity against mouse hepatitis virus.Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) is the recombinant mouse-derived Lymphocyte antigen 6E/LY6E protein, expressed by P.pastoris , with N-His, N-SUMO labeled tag.

LY6E, a glycosylphosphatidylinositol (GPI)-anchored cell surface protein, intricately governs T-lymphocyte functions, including proliferation, differentiation, and activation. It exerts its regulatory influence on T-cell receptor (TCR) signaling by engaging with the CD3Z/CD247 component at the plasma membrane, thereby modulating the phosphorylation of CD3Z/CD247. Beyond its role in immune response modulation, LY6E exhibits antiviral activity by impeding the entry of murine coronavirus, specifically mouse hepatitis virus, through interference with spike protein-mediated membrane fusion. Additionally, LY6E plays a pivotal role in placenta formation, acting as the primary receptor for syncytin-A (SynA), thus contributing to the proper morphogenesis of both fetal and maternal vasculatures within the placenta. Notably, LY6E may function as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, demonstrated by its interaction with CHRNA4 and its inhibitory effect on alpha-3:beta-4-containing nAChRs in vitro.

Mouse

P. pastoris

N-His;N-SUMO

Q64253 (21L-102A)

17069  [NCBI]

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Approximately 24.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.