1. Recombinant Proteins
  2. Others
  3. Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)

Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)

Cat. No.: HY-P71830
Handling Instructions Technical Support

LY6E is a GPI-anchored cell surface protein that regulates T lymphocyte function by binding to CD3Z/CD247, affecting proliferation, differentiation and activation.It modulates T cell receptor signaling and exhibits antiviral activity against mouse hepatitis virus.Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) is the recombinant mouse-derived Lymphocyte antigen 6E/LY6E protein, expressed by P.pastoris , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LY6E is a GPI-anchored cell surface protein that regulates T lymphocyte function by binding to CD3Z/CD247, affecting proliferation, differentiation and activation.It modulates T cell receptor signaling and exhibits antiviral activity against mouse hepatitis virus.Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) is the recombinant mouse-derived Lymphocyte antigen 6E/LY6E protein, expressed by P.pastoris , with N-His, N-SUMO labeled tag.

Background

LY6E, a glycosylphosphatidylinositol (GPI)-anchored cell surface protein, intricately governs T-lymphocyte functions, including proliferation, differentiation, and activation. It exerts its regulatory influence on T-cell receptor (TCR) signaling by engaging with the CD3Z/CD247 component at the plasma membrane, thereby modulating the phosphorylation of CD3Z/CD247. Beyond its role in immune response modulation, LY6E exhibits antiviral activity by impeding the entry of murine coronavirus, specifically mouse hepatitis virus, through interference with spike protein-mediated membrane fusion. Additionally, LY6E plays a pivotal role in placenta formation, acting as the primary receptor for syncytin-A (SynA), thus contributing to the proper morphogenesis of both fetal and maternal vasculatures within the placenta. Notably, LY6E may function as a modulator of nicotinic acetylcholine receptors (nAChRs) activity, demonstrated by its interaction with CHRNA4 and its inhibitory effect on alpha-3:beta-4-containing nAChRs in vitro.

Species

Mouse

Source

P. pastoris

Tag

N-His;N-SUMO

Accession

Q64253 (21L-102A)

Gene ID
Molecular Construction
N-term
6*His-SUMO
LY6E (21L-102A)
Accession # Q64253
C-term
Synonyms
Ly6e; Ly67; Sca-2; Tsa-1Lymphocyte antigen 6E; Ly-6E; Stem cell antigen 2; Thymic shared antigen 1; TSA-1
AA Sequence

LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Molecular Weight

Approximately 24.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lymphocyte antigen 6E/LY6E Protein, Mouse (P.pastoris, His, SUMO)
Cat. No.:
HY-P71830
Quantity:
MCE Japan Authorized Agent: