1. Recombinant Proteins
  2. Others
  3. LYPD3/C4.4A Protein, Human (HEK293, His)

LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LYPD3/C4.4A protein facilitates cell migration and potentially influences urothelial cell-matrix interactions.It plays a role in tumor progression, binding to laminin-1 and laminin-5.Interactions with LGALS3, AGR2, and AGR3 emphasize its functional associations and impact in diverse biological processes.LYPD3/C4.4A Protein, Human (HEK293, His) is the recombinant human-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The LYPD3/C4.4A protein supports cell migration and may play a role in urothelial cell-matrix interactions. It is also implicated in tumor progression and has been shown to bind to laminin-1 and laminin-5. Additionally, it interacts with LGALS3, AGR2, and AGR3, further highlighting its functional associations and potential impact in various biological processes.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95274 (L31-H286)

Gene ID
Molecular Construction
N-term
LYPD3 (L31-H286)
Accession # O95274
6*His
C-term
Synonyms
rHuLy6/PLAUR domain-containing protein 3, His; Ly6/PLAUR Domain-Containing Protein 3; GPI-Anchored Metastasis-Associated Protein C4.4A Homolog; Matrigel-Induced Gene C4 Protein; MIG-C4; LYPD3; C4.4A
AA Sequence

LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEH

Molecular Weight

55-75 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LYPD3/C4.4A Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LYPD3/C4.4A Protein, Human (HEK293, His)
Cat. No.:
HY-P70219
Quantity:
MCE Japan Authorized Agent: