1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Rat (HEK293)

The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The M-CSF protein regulates hematopoietic precursor cells, promoting their survival, proliferation, and differentiation. M-CSF Protein, Rat (HEK293) is the recombinant rat-derived M-CSF protein, expressed by HEK293 , with tag free.

Background

M-CSF Protein assumes a crucial role in orchestrating the regulation of survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. Its significance extends to promoting the release of pro-inflammatory chemokines, thereby playing a pivotal role in innate immunity and inflammatory processes. Moreover, M-CSF is a key player in the regulation of osteoclast proliferation and differentiation, influencing bone resorption and contributing to normal bone development. Beyond its impact on the skeletal system, M-CSF is indispensable for normal male and female fertility. The cytokine also plays a role in lipoprotein clearance and contributes to cellular processes such as reorganizing the actin cytoskeleton, regulating the formation of membrane ruffles, cell adhesion, and cell migration. M-CSF can exist in various forms, including a homodimer with two identical 150-200 kDa proteoglycan subunits, a heterodimer with a 150-200 kDa proteoglycan subunit and a truncated 43 kDa subunit, and a homodimer with two identical 43 kDa subunits. It interacts with its receptor CSF1R to exert its diverse functions.

Biological Activity

Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.02302 ng/mL, corresponding to a specific activity is 4.34×107 units/mg.

  • Measured in a cell proliferation assay using M-NFS-60 cells. The ED50 for this effect is 0.02302 ng/mL, corresponding to a specific activity is 4.34×107 units/mg.
Species

Rat

Source

HEK293

Tag

Tag Free

Accession

Q8JZQ0 (E33-R254)

Gene ID
Molecular Construction
N-term
M-CSF (E33-R254)
Accession # Q8JZQ0
C-term
Synonyms
Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; CSF1
AA Sequence

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQRTEGSSLLPSDLPLRIEDPGSAKQRPPR

Molecular Weight

Approximately 46.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

M-CSF Protein, Rat (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
M-CSF Protein, Rat (HEK293)
Cat. No.:
HY-P70493
Quantity:
MCE Japan Authorized Agent: