1. Recombinant Proteins
  2. Others
  3. MAGP-2/MFAP5 Protein, Human (His-SUMO)

MAGP-2/MFAP5 Protein, Human (His-SUMO)

Cat. No.: HY-P76494A
SDS COA Handling Instructions

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $53 In-stock
10 μg $85 In-stock
50 μg $220 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (His-SUMO) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The MAGP-2/MFAP5 protein is suggested to potentially play a role in hematopoiesis, indicating its involvement in crucial processes related to blood cell formation. In the cardiovascular system, it is proposed to regulate growth factors or participate in cell signaling to maintain the integrity of large vessels. Notably, MAGP-2/MFAP5 functions as a component of the elastin-associated microfibrils, contributing to the structural organization of these extracellular matrix elements. Additionally, it interacts with key signaling molecules such as TGFB2 and BMP2, suggesting a role in modulating signaling pathways. Furthermore, MAGP-2/MFAP5 engages in interactions with FBN1 and FBN2, emphasizing its involvement in the dynamic network of proteins associated with fibrillin and contributing to the overall maintenance of tissue architecture and function. The multifaceted functions and molecular interactions of MAGP-2/MFAP5 underscore its significance in both hematopoiesis and cardiovascular homeostasis.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q13361-1 (I22-L173)

Gene ID

8076

Synonyms
MAGP2; MAGP-2; MAGP2MFAP-5; MFAP5; Microfibril-associated glycoprotein 2; microfibrillar associated protein 5; microfibrillar-associated protein 5; MP25; MP25microfibril-associated glycoprotein-2; Q13361
AA Sequence

IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL

Molecular Weight

Approximately 36 kDa.

Purity

Greater than 90% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MAGP-2/MFAP5 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAGP-2/MFAP5 Protein, Human (His-SUMO)
Cat. No.:
HY-P76494A
Quantity:
MCE Japan Authorized Agent: