1. Recombinant Proteins
  2. Others
  3. Major urinary protein 11 Protein, Mouse (His)

Major urinary protein 11 Protein, Mouse (His)

Cat. No.: HY-P71506
Handling Instructions Technical Support

Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT). Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Major urinary protein 11 Protein functions as a key player in pheromone binding, stabilizing and facilitating their slow release from urine marks. It may safeguard pheromones from oxidation and potentially acts as a pheromone itself, influencing social behaviors like aggression, mating, pup-suckling, territory establishment, and dominance. The protein exhibits in vitro binding to the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT). Major urinary protein 11 Protein, Mouse (His) is the recombinant mouse-derived Major urinary protein 11 protein, expressed by E. coli , with N-His labeled tag.

Background

Major urinary protein 11 Protein, a member of the Major urinary proteins (Mups) family, plays a crucial role in binding pheromones, stabilizing them for slow release into the air through urine marks. This function may protect pheromones from oxidation and, intriguingly, Mups themselves may act as pheromones. In the context of social behaviors, including aggression, mating, pup-suckling, territory establishment, and dominance, Major urinary protein 11 is presumed to contribute to the regulation of these behaviors. Additionally, in vitro studies indicate its ability to bind the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT).

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P04938 (E32-E181)

Gene ID

100039028  [NCBI]

Molecular Construction
N-term
His
Mup11 (E32-E181)
Accession # P04938
C-term
Synonyms
Mup11; Mup9Major urinary protein 11
AA Sequence

REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE

Molecular Weight

Approximately 23.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Major urinary protein 11 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Major urinary protein 11 Protein, Mouse (His)
Cat. No.:
HY-P71506
Quantity:
MCE Japan Authorized Agent: