Major urinary protein 2 Protein, Mouse (P.pastoris, His)

Major Urinary Protein 2 (MUP2) is pivotal in chemical communication, binding to pheromones in male urine.This specific interaction significantly influences female sexual behavior, highlighting MUP2's essential role in mediating chemical signaling within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.Major urinary protein 2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Major urinary protein 2 protein, expressed by P.pastoris , with N-His labeled tag.

The Major Urinary Protein 2 (MUP2) plays a crucial role in chemical communication by binding to pheromones released from drying urine of males. This specific interaction with male-derived pheromones is instrumental in influencing the sexual behavior of females. MUP2's ability to bind to these pheromones underscores its essential function in mediating chemical signaling and communication within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.

Mouse

P. pastoris

N-His

P11589 (19E-180E)

17841  [NCBI]

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Approximately 20.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.