1. Recombinant Proteins
  2. Others
  3. Major urinary protein 2 Protein, Mouse (P.pastoris, His)

Major urinary protein 2 Protein, Mouse (P.pastoris, His)

Cat. No.: HY-P71797
Handling Instructions Technical Support

Major Urinary Protein 2 (MUP2) is pivotal in chemical communication, binding to pheromones in male urine.This specific interaction significantly influences female sexual behavior, highlighting MUP2's essential role in mediating chemical signaling within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.Major urinary protein 2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Major urinary protein 2 protein, expressed by P.pastoris , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Major Urinary Protein 2 (MUP2) is pivotal in chemical communication, binding to pheromones in male urine.This specific interaction significantly influences female sexual behavior, highlighting MUP2's essential role in mediating chemical signaling within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.Major urinary protein 2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Major urinary protein 2 protein, expressed by P.pastoris , with N-His labeled tag.

Background

The Major Urinary Protein 2 (MUP2) plays a crucial role in chemical communication by binding to pheromones released from drying urine of males. This specific interaction with male-derived pheromones is instrumental in influencing the sexual behavior of females. MUP2's ability to bind to these pheromones underscores its essential function in mediating chemical signaling and communication within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.

Species

Mouse

Source

P. pastoris

Tag

N-His

Accession

P11589 (19E-180E)

Gene ID

17841  [NCBI]

Molecular Construction
N-term
His
Mup2 (19E-180E)
Accession # P11589
C-term
Synonyms
Mup2; Major urinary protein 2; MUP 2
AA Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Molecular Weight

Approximately 20.7 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Major urinary protein 2 Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Major urinary protein 2 Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P71797
Quantity:
MCE Japan Authorized Agent: