MAPKSP1 Protein, Human (His)

The MAPKSP1 protein, also known as porphobilinogen deaminase (HMBS), is crucial in the heme biosynthetic pathway and catalyzes the sequential polymerization of four porphobilinogen molecules to form hydroxymethyl bixane. The process begins with the assembly of the dipyrromethane cofactor of porphobilinogen or preuroporphyrinogen. MAPKSP1 Protein, Human (His) is the recombinant human-derived MAPKSP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of MAPKSP1 Protein, Human (His) is 124 a.a., with molecular weight of ~15.0 kDa.

HMBS, also known as Porphobilinogen deaminase, plays a crucial role in the heme biosynthetic pathway by catalyzing the sequential polymerization of four molecules of porphobilinogen, resulting in the formation of hydroxymethylbilane, also referred to as preuroporphyrinogen. The catalytic process commences with the assembly of the dipyrromethane cofactor, formed either from two molecules of porphobilinogen or from preuroporphyrinogen, by the apoenzyme. The covalently linked cofactor serves as a primer, orchestrating the assembly of the tetrapyrrole product around it. In the final step of catalysis, the product, preuroporphyrinogen, is released, while the cofactor remains bound to the holodeaminase intact, highlighting the intricate and essential role of HMBS in the synthesis of heme.

Human

E. coli

N-6*His

Q9UHA4 (M1-S124)

8649  [NCBI]

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Approximately 15.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 5 mM DTT, 30% Glycerol, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.