1. Recombinant Proteins
  2. Others
  3. MAPKSP1 Protein, Human (His)

The MAPKSP1 protein, also known as porphobilinogen deaminase (HMBS), is crucial in the heme biosynthetic pathway and catalyzes the sequential polymerization of four porphobilinogen molecules to form hydroxymethyl bixane. The process begins with the assembly of the dipyrromethane cofactor of porphobilinogen or preuroporphyrinogen. MAPKSP1 Protein, Human (His) is the recombinant human-derived MAPKSP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of MAPKSP1 Protein, Human (His) is 124 a.a., with molecular weight of ~15.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MAPKSP1 protein, also known as porphobilinogen deaminase (HMBS), is crucial in the heme biosynthetic pathway and catalyzes the sequential polymerization of four porphobilinogen molecules to form hydroxymethyl bixane. The process begins with the assembly of the dipyrromethane cofactor of porphobilinogen or preuroporphyrinogen. MAPKSP1 Protein, Human (His) is the recombinant human-derived MAPKSP1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of MAPKSP1 Protein, Human (His) is 124 a.a., with molecular weight of ~15.0 kDa.

Background

HMBS, also known as Porphobilinogen deaminase, plays a crucial role in the heme biosynthetic pathway by catalyzing the sequential polymerization of four molecules of porphobilinogen, resulting in the formation of hydroxymethylbilane, also referred to as preuroporphyrinogen. The catalytic process commences with the assembly of the dipyrromethane cofactor, formed either from two molecules of porphobilinogen or from preuroporphyrinogen, by the apoenzyme. The covalently linked cofactor serves as a primer, orchestrating the assembly of the tetrapyrrole product around it. In the final step of catalysis, the product, preuroporphyrinogen, is released, while the cofactor remains bound to the holodeaminase intact, highlighting the intricate and essential role of HMBS in the synthesis of heme.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9UHA4 (M1-S124)

Gene ID
Molecular Construction
N-term
6*His
MAPKSP1 (M1-S124)
Accession # Q9UHA4
C-term
Synonyms
Ragulator Complex Protein LAMTOR3; Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 3; MEK-Binding Partner 1; Mp1; Mitogen-Activated Protein Kinase Kinase 1-Interacting Protein 1; Mitogen-Activated Protein Kinase Scaffold Protein 1; LAMTOR3; MAP2K1IP
AA Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Molecular Weight

Approximately 15.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 5 mM DTT, 30% Glycerol, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MAPKSP1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MAPKSP1 Protein, Human (His)
Cat. No.:
HY-P70931
Quantity:
MCE Japan Authorized Agent: