MARCH2 Protein, Human (Cell-Free, His, SUMO)

The MARCH2 protein acts as an E3 ubiquitin protein ligase, promoting endocytosis and sorting of TFRC and CD86 to lysosomes. MARCH2 Protein, Human (Cell-Free, His, SUMO) is the recombinant human-derived MARCH2 protein, expressed by E. coli Cell-free , with N-6*His, N-SUMO labeled tag. The total length of MARCH2 Protein, Human (Cell-Free, His, SUMO) is 246 a.a., with molecular weight of 43 kDa.

MARCH2, an E3 ubiquitin-protein ligase, orchestrates diverse cellular processes by mediating the ubiquitination and subsequent endocytosis of various substrates. It is implicated in the ubiquitination and lysosomal degradation of transferrin receptor (TFRC) and CD86, suggesting a role in regulating their cellular levels. Collaborating with GOPC/CAL, MARCH2 participates in the ubiquitination and lysosomal degradation of CFTR. Additionally, it regulates the intracellular trafficking and secretion of alpha1-antitrypsin/SERPINA1 and haptoglobin/HP by ubiquitinating and promoting the degradation of the cargo receptor ERGIC3. MARCH2 negatively modulates antiviral and antibacterial immune responses by repressing NF-kB and type 1 interferon signaling pathways through K48-linked polyubiquitination of IKBKG/NEMO. Moreover, its involvement in endosomal trafficking is indicated by its interaction with STX6. In the context of microbial infection, MARCH2 positively influences the degradation of the Vesicular stomatitis virus (VSV) G protein via the lysosomal degradation pathway, and it represses HIV-1 viral production, potentially impeding the translocation of HIV-1 env to the cell surface and reducing viral cell-cell transmission.

Human

E. coli Cell-free

N-6*His;N-SUMO

Q9P0N8 (M1-V246)

/

MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEWLKDPGPRTEKRTLCCDMVCFLFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV

43 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.