1. Recombinant Proteins
  2. Receptor Proteins
  3. MARCO Protein, Mouse (HEK293, His)

MARCO Protein, Mouse (HEK293, His)

Cat. No.: HY-P70855
SDS COA Handling Instructions

MARCO Protein, a pattern recognition receptor (PRR), binds Gram-positive and Gram-negative bacteria, exhibiting a crucial role in unopsonized particle binding by alveolar macrophages.Furthermore, it interacts with the secretoglobin SCGB3A2.MARCO Protein forms disulfide-linked homotrimer structures that assemble into larger oligomers, providing an extensive surface area for interactions with substantial ligands.MARCO Protein, Mouse (HEK293, His) is the recombinant mouse-derived MARCO protein, expressed by HEK293 , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $89 In-stock
50 μg $250 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MARCO Protein, a pattern recognition receptor (PRR), binds Gram-positive and Gram-negative bacteria, exhibiting a crucial role in unopsonized particle binding by alveolar macrophages.Furthermore, it interacts with the secretoglobin SCGB3A2.MARCO Protein forms disulfide-linked homotrimer structures that assemble into larger oligomers, providing an extensive surface area for interactions with substantial ligands.MARCO Protein, Mouse (HEK293, His) is the recombinant mouse-derived MARCO protein, expressed by HEK293 , with N-8*His labeled tag.

Background

MARCO Protein is a pattern recognition receptor (PRR) that has the ability to bind both Gram-positive and Gram-negative bacteria. It also plays a role in binding unopsonized particles by alveolar macrophages. Additionally, MARCO Protein can bind to the secretoglobin SCGB3A2. It forms a homotrimer structure that is disulfide-linked, and these trimers can further assemble into larger oligomers, creating a large surface area capable of interacting with very large ligands.

Species

Mouse

Source

HEK293

Tag

N-8*His

Accession

Q60754 (Q70-S518)

Gene ID
Molecular Construction
N-term
8*His
MARCO (Q70-S518)
Accession # Q60754
C-term
Synonyms
Macrophage receptor MARCO; Marco; Macrophage receptor with collage
AA Sequence

QVLNLQEQLQMLEMCCGNGSLAIEDKPFFSLQWAPKTHLVPRAQGLQALQAQLSWVHTSQEQLRQQFNNLTQNPELFQIKGERGSPGPKGAPGAPGIPGLPGPAAEKGEKGAAGRDGTPGVQGPQGPPGSKGEAGLQGLTGAPGKQGATGAPGPRGEKGSKGDIGLTGPKGEHGTKGDKGDLGLPGNKGDMGMKGDTGPMGSPGAQGGKGDAGKPGLPGLAGSPGVKGDQGKPGVQGVPGPQGAPGLSGAKGEPGRTGLPGPAGPPGIAGNPGIAGVKGSKGDTGIQGQKGTKGESGVPGLVGRKGDTGSPGLAGPKGEPGRVGQKGDPGMKGSSGQQGQKGEKGQKGESFQRVRIMGGTNRGRAEVYYNNEWGTICDDDWDNNDATVFCRMLGYSRGRALSSYGGGSGNIWLDNVNCRGTENSLWDCSKNSWGNHNCVHNEDAGVECS

Molecular Weight

55-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

MARCO Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MARCO Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70855
Quantity:
MCE Japan Authorized Agent: