Matriptase/ST14 Catalytic Domain Protein, Human (His)

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

The Matriptase/ST14 Catalytic Domain Protein is an integral membrane serine protease derived from epithelial cells. It forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is activated by sphingosine 1-phosphate. This protease has been demonstrated to cleave and activate hepatocyte growth factor/scattering factor, as well as urokinase plasminogen activator, suggesting its role as an activator for other proteases and latent growth factors on the epithelial membrane. The expression of this protease has been linked to breast, colon, prostate, and ovarian tumors, indicating its involvement in cancer invasion and metastasis. It exhibits broad expression in colon (RPKM 103.0), small intestine (RPKM 72.7), and 15 other tissues.

Measured by its ability to cleave the fluorogenic peptide substrate BOC-Gln-Ala-Arg-AMC (HY-134432A) that incubate at room temperature for 5 min. The specific activity is 43374.15 pmol/min/µg.

Human

E. coli

N-6*His

NP_068813 (G596-V855)

6768

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Approximately 28 kDa (major) and minor auto-activation fragments

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 150 mM NaCl, pH 7.5, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.