1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Matriptase/ST14 Catalytic Domain Protein, Human (His)

Matriptase/ST14 Catalytic Domain Protein, Human (His)

Cat. No.: HY-P702523
Handling Instructions Technical Support

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
> 250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Matriptase/ST14 catalytic domain protein originates from epithelial cells, forms a complex with HAI-1, and is activated by sphingosine-1-phosphate. It cleaves and activates hepatocyte growth factor/scatter factor and urokinase plasminogen activator, suggesting its role as an activator of other proteases and potential growth factors. Matriptase/ST14 Catalytic Domain Protein, Human (His) is the recombinant human-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

Background

The Matriptase/ST14 Catalytic Domain Protein is an integral membrane serine protease derived from epithelial cells. It forms a complex with the Kunitz-type serine protease inhibitor, HAI-1, and is activated by sphingosine 1-phosphate. This protease has been demonstrated to cleave and activate hepatocyte growth factor/scattering factor, as well as urokinase plasminogen activator, suggesting its role as an activator for other proteases and latent growth factors on the epithelial membrane. The expression of this protease has been linked to breast, colon, prostate, and ovarian tumors, indicating its involvement in cancer invasion and metastasis. It exhibits broad expression in colon (RPKM 103.0), small intestine (RPKM 72.7), and 15 other tissues.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate BOC-Gln-Ala-Arg-AMC (HY-134432A) that incubate at room temperature for 5 min. The specific activity is 43374.15 pmol/min/µg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

NP_068813 (G596-V855)

Gene ID

6768

Molecular Construction
N-term
6*His
Matriptase (G596-V855)
Accession # NP_068813
C-term
Synonyms
EC 3.4.21; Epithin; HAI; Matriptase; Membrane-type serine protease 1; MTSP1; MT-SP1EC 3.4.21.109; prostamin; PRSS14; Serine protease 14; Serine protease TADG-15; SNC19; SNC19MTSP1; ST14; suppressor of tumorigenicity 14 protein; TADG15; TADG-15; TMPRSS14; tumor associated differentially expressed gene 15 protein; Tumor-associated differentially-expressed gene 15 protein
AA Sequence

GSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV

Molecular Weight

Approximately 28 kDa (major) and minor auto-activation fragments

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 150 mM NaCl, pH 7.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Matriptase/ST14 Catalytic Domain Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Matriptase/ST14 Catalytic Domain Protein, Human (His)
Cat. No.:
HY-P702523
Quantity:
MCE Japan Authorized Agent: