1. Recombinant Proteins
  2. Complement System
  3. Mannose-binding Protein
  4. Mannose-binding Protein C
  5. MBL2/COLEC1 Protein, Human (HEK293, His)

The MBL2/COLEC1 protein is a calcium-dependent lectin in innate immune defense that activates the lectin complement pathway by binding to mannose, fucose, and N-acetylglucosamine on microorganisms. MBL2/COLEC1 Protein, Human (HEK293, His) is the recombinant human-derived MBL2/COLEC1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of MBL2/COLEC1 Protein, Human (HEK293, His) is 228 a.a., with molecular weight of ~31.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MBL2/COLEC1 protein is a calcium-dependent lectin in innate immune defense that activates the lectin complement pathway by binding to mannose, fucose, and N-acetylglucosamine on microorganisms. MBL2/COLEC1 Protein, Human (HEK293, His) is the recombinant human-derived MBL2/COLEC1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of MBL2/COLEC1 Protein, Human (HEK293, His) is 228 a.a., with molecular weight of ~31.0 kDa.

Background

MBL2, also known as COLEC1, is a calcium-dependent lectin actively involved in innate immune defense. This versatile protein binds to mannose, fucose, and N-acetylglucosamine on diverse microorganisms, initiating the lectin complement pathway. Furthermore, MBL2 exhibits a unique affinity for late apoptotic cells, apoptotic blebs, and necrotic cells, facilitating their efficient uptake by macrophages. Additionally, there is evidence suggesting its potential binding to DNA. In the context of SARS coronavirus-2 (SARS-CoV-2) infection, MBL2 plays a critical role in activating the complement lectin pathway, leading to the inhibition of SARS-CoV-2 infection and a reduction in the induced inflammatory response. Structurally, MBL2 forms oligomeric complexes composed of three or more homotrimers. Its functional interactions extend to MASP1, MASP2, MEP1A, MEP1B, and CR1, indicating its involvement in various regulatory and immune-related pathways.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P11226 (E21-I248)

Gene ID
Molecular Construction
N-term
MBL2 (E21-I248)
Accession # P11226
6*His
C-term
Synonyms
rHuMannose-binding protein C/MBL-2, His; Mannose-Binding Protein C; MBP-C; Collectin-1; MBP1; Mannan-Binding Protein; Mannose-Binding Lectin; MBL2; COLEC1; MBL
AA Sequence

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Molecular Weight

Approximately 31-32.1 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 5% Threhalose, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MBL2/COLEC1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MBL2/COLEC1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70281
Quantity:
MCE Japan Authorized Agent: