MBL1 Protein, Mouse (HEK293, His)

MBL1, a calcium-dependent lectin, recognizes microbial moieties, activating the lectin complement pathway.It also binds apoptotic and necrotic cells, aiding uptake by macrophages.As a homotrimer, MBL1 forms higher oligomeric complexes in the endoplasmic reticulum.MBL1's interaction with MASP1 and MASP2 enhances its role in immune response modulation and cellular recognition.MBL1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MBL1 protein, expressed by HEK293 , with N-His, N-6*His labeled tag.

MBL1, a calcium-dependent lectin, plays a crucial role in the innate immune response by recognizing mannose, fucose, and N-acetylglucosamine moieties on various microorganisms, thereby activating the lectin complement pathway. Beyond its microbial interactions, MBL1 also binds to late apoptotic cells, apoptotic blebs, and necrotic cells, facilitating their uptake by macrophages. Existing as a homotrimer, MBL1 further assembles into higher oligomeric complexes through the association of two, three, or more homotrimers, a process occurring in the endoplasmic reticulum. Additionally, MBL1 interacts with MASP1 and MASP2, further contributing to its involvement in immune response modulation and cellular recognition processes.

Mouse

HEK293

N-6*His

P39039/NP_034905.1 (S21-A239)

17194  [NCBI]

SQTCEDTLKTCSVIACGRDGRDGPKGEKGEPGQGLRGLQGPPGKLGPPGSVGSPGSPGPKGQKGDHGDNRAIEEKLANMEAEIRILKSKLQLTNKLHAFSMGKKSGKKLFVTNHEKMPFSKVKSLCTELQGTVAIPRNAEENKAIQEVATGIAFLGITDEATEGQFMYVTGGRLTYSNWKKDEPNNHGSGEDCVIILDNGLWNDISCQASFKAVCEFPA

Approximately 32 kDa.

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.