1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. MCP-2 Protein/CCL8
  6. MCP-2/CCL8 Protein, Mouse

MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg USD 37 In-stock
10 μg USD 82 In-stock
50 μg USD 231 In-stock
100 μg USD 394 In-stock
> 100 μg   Get quote  

Get it by May 1 for select sizes. Order within 21 hrs 3 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE MCP-2/CCL8 Protein, Mouse

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli[1][2].

Background

CCL8, also known as monocyte chemotactic protein 2 ( MCP2), is a small cell factor belonging to the CC chemokine family. First identified in human osteosarcoma cells, it is a protein encoded by the CCL8 gene located on human chromosome 17. CCL8 is mainly expressed in small intestine and peripheral blood cells. CCL8 can bind to several different chemokine cell surface receptors, such as CCR1, CCR2B, CCR3 and CCR5. CCL8 can act as a chemoattractant, attracting chemokines such as monocytes, lymphocytes, basophils and eosinophils to mediate inflammatory host responses. On the one hand, CCL8 contributes to the spread of breast cancer and promotes the migration and invasion of esophageal squamous cell carcinoma. On the other hand, it has also been reported that CCL8 inhibits cervical cancer tumor growth and exhibits anti-tumor metastatic effects in melanoma. cCL8 significantly activates ERK1/2 phosphorylation in glioblastoma cells and significantly reduces the invasiveness of glioma cells by neutralizing antibody blockade of tama-secreted CCL8. At the same time, CCL8 can act as a potent HIV1 inhibitor with high affinity for the receptor CCR5, which is one of the major co-receptors for HIV1[1][2].

In Vitro

MCP2/CCL8 (20-180 µg/mL) can stimulate the proliferation of splenic lymphocytes of immunosuppressed mice in a dose-dependent manner, with the highest proliferation index at a concentration of 180 μg/mL, which is 3.82 times higher than that of the normal group[3].

In Vivo

MCP2/CCL8(i.p., 1 μg in 200 μL of PBS, once daily, 14 days) decreases in the number and size of tumor colonies in the liver compared with vector-treated mice, suggesting an anti-tumor metastatic effect in C57BL/6 mice with B16 F10 cells[4].

Biological Activity

1. Full biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.
2. Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 0.05265 μg/mL, corresponding to a specific activity is 1.899×10^4 U/mg.

  • Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 0.05265 μg/mL,corresponding to a specific activity is 1.899×104 U/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q9Z121 (G24-P97)

Gene ID
Molecular Construction
N-term
CCL8 (G24-P97)
Accession # Q9Z121
C-term
Synonyms
rMuMCP-2/CCL8; C-C motif chemokine 8; MCP-2; SCYA10; SCYA8
AA Sequence

GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

Molecular Weight

Approximately 10.54 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl or 20 mM PB, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

MCP-2/CCL8 Protein, Mouse Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MCP-2/CCL8 Protein, Mouse
Cat. No.:
HY-P7239
Quantity:
MCE Japan Authorized Agent: