MCV-type II Chemokine-like Protein, Virus

MCV-type II Chemokine-like Protein, Virus is the recombinant Virus-derived MCV-type II Chemokine-like protein, expressed by E. coli , with tag free. The total length of MCV-type II Chemokine-like Protein, Virus is 80 a.a., with molecular weight of ~9.1 kDa.

Measured by its ability to block I-309-induced chemotaxis of THP‑1 cells. The ED₅₀ for this effect is 20.44 ng/mL, corresponding to a specific activity is 4.892×10⁴ U/mg.

• 
  Measured by its ability to block I-309-induced chemotaxis of THP‑1 cells. The ED₅₀ for this effect is 20.44 ng/mL, corresponding to a specific activity is 4.892×10⁴ U/mg.

Virus

E. coli

Tag Free

O41924/AAB72041 (L25-L104)

/

LSRRKCCLNPTNRPIPRPLLQDLDKVDYQPMGHDCGREAFRVTLQDGRQGCVSVGNQSLLDWLKGHKDLCPRMWPGCESL

Approximately 10 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.