MDH1 Protein, Rat (His)

MDH1 Protein, an enzyme, is involved in the citric acid cycle and the conversion of malate to oxaloacetate.Dysregulation of MDH1 Protein has been associated with metabolic disorders and cancer.Targeting MDH1 Protein may provide potential therapeutic interventions by modulating energy metabolism, inhibiting tumor growth, and potentially treating these conditions.MDH1 Protein, Rat (His) is the recombinant rat-derived MDH1 protein, expressed by E.coli , with C-His labeled tag.

The MDH1 protein, an important enzyme, is responsible for catalyzing the reduction of aromatic alpha-keto acids when NADH is present. It serves critical functions in both the malate-aspartate shuttle and the tricarboxylic acid cycle, which are crucial for providing mitochondrial NADH supply needed for oxidative phosphorylation. Additionally, MDH1 catalyzes the reduction of 2-oxoglutarate to 2-hydroxyglutarate, a process that can result in increased levels of reactive oxygen species (ROS).

Specific activity is 2524.23 units/mg, and is defined as the amount of enzyme that cleaves 1.0 μmole of oxalacetate and beta-NADH to L-malate and beta-NAD per minute at pH 8.0 at 37ºC.

Rat

E. coli

C-His

O88989 (M1-A334)

24551  [NCBI]

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA

Approximately 39 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCL, 300 mM NaCl, pH 7.4, 10% Glycerol.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.