1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. MDH1 Protein, Rat (His)

MDH1 Protein, an enzyme, is involved in the citric acid cycle and the conversion of malate to oxaloacetate.Dysregulation of MDH1 Protein has been associated with metabolic disorders and cancer.Targeting MDH1 Protein may provide potential therapeutic interventions by modulating energy metabolism, inhibiting tumor growth, and potentially treating these conditions.MDH1 Protein, Rat (His) is the recombinant rat-derived MDH1 protein, expressed by E.coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MDH1 Protein, an enzyme, is involved in the citric acid cycle and the conversion of malate to oxaloacetate.Dysregulation of MDH1 Protein has been associated with metabolic disorders and cancer.Targeting MDH1 Protein may provide potential therapeutic interventions by modulating energy metabolism, inhibiting tumor growth, and potentially treating these conditions.MDH1 Protein, Rat (His) is the recombinant rat-derived MDH1 protein, expressed by E.coli , with C-His labeled tag.

Background

The MDH1 protein, an important enzyme, is responsible for catalyzing the reduction of aromatic alpha-keto acids when NADH is present. It serves critical functions in both the malate-aspartate shuttle and the tricarboxylic acid cycle, which are crucial for providing mitochondrial NADH supply needed for oxidative phosphorylation. Additionally, MDH1 catalyzes the reduction of 2-oxoglutarate to 2-hydroxyglutarate, a process that can result in increased levels of reactive oxygen species (ROS).

Biological Activity

Specific activity is 2524.23 units/mg, and is defined as the amount of enzyme that cleaves 1.0 μmole of oxalacetate and beta-NADH to L-malate and beta-NAD per minute at pH 8.0 at 37ºC.

Species

Rat

Source

E. coli

Tag

C-His

Accession

O88989 (M1-A334)

Gene ID
Molecular Construction
N-term
MDH1 (M4-A334)
Accession # O88989
His
C-term
Synonyms
Malate Dehydrogenase Cytoplasmic; Cytosolic Malate Dehydrogenase; MDH1; MDHA
AA Sequence

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAISDHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA

Molecular Weight

Approximately 39 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCL, 300 mM NaCl, pH 7.4, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MDH1 Protein, Rat (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDH1 Protein, Rat (His)
Cat. No.:
HY-P74757
Quantity:
MCE Japan Authorized Agent: