1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. MDM2 Protein, Human

MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human is the recombinant human-derived MDM2 protein, expressed by E. coli , with tag free. The total length of MDM2 Protein, Human is 95 a.a., with molecular weight of 11.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MDM2 protein is a key E3 ubiquitin protein ligase that coordinates cellular processes by ubiquitinating and degrading p53/TP53 and inhibiting its tumor suppressor function. In addition to p53/TP53 regulation, MDM2 inhibits p53/TP53- and p73/TP73-mediated responses, self-ubiquitinates, and targets ARRB1 for degradation. MDM2 Protein, Human is the recombinant human-derived MDM2 protein, expressed by E. coli , with tag free. The total length of MDM2 Protein, Human is 95 a.a., with molecular weight of 11.1 kDa.

Background

MDM2 Protein, an E3 ubiquitin-protein ligase, plays a central role in the intricate regulation of cellular processes by mediating the ubiquitination and subsequent proteasomal degradation of the tumor suppressor p53/TP53, leading to its downregulation. Beyond its interaction with p53/TP53, MDM2 inhibits p53/TP53- and p73/TP73-mediated cell cycle arrest and apoptosis by binding to their transcriptional activation domain, highlighting its role as a negative regulator of these critical cellular responses. Not limited to its interactions with p53/TP53, MDM2 functions as a ubiquitin ligase E3 toward itself and ARRB1, permitting the nuclear export of p53/TP53 and promoting the proteasome-dependent ubiquitin-independent degradation of retinoblastoma RB1 protein. Additionally, MDM2 inhibits DAXX-mediated apoptosis by inducing its ubiquitination and degradation, demonstrating its versatile involvement in apoptotic pathways. As a component of various complexes, including TRIM28/KAP1-MDM2-p53/TP53 and TRIM28/KAP1-ERBB4-MDM2, MDM2 links growth factor and DNA damage response pathways. It further mediates ubiquitination and proteasome degradation of DYRK2, IGF1R, SNAI1, DCX, and DLG4, influencing diverse cellular functions such as dendritic spine density, receptor endocytosis, and mitochondrial respiration. Through its interactions with NDUFS1, MDM2 negatively regulates mitochondrial respiration, leading to increased oxidative stress and commitment to the mitochondrial pathway of apoptosis. These multifaceted roles underscore the intricate regulatory functions of MDM2 in cellular homeostasis and stress responses.

Biological Activity

Measured in a cell proliferation assay using PC-9 cells. The ED50 for this effect is 0.4445 μg/mL, corresponding to a specific activity is 2.249×103 units/mg.

  • Measured in a cell proliferation assay using PC-9 cells. The ED50 for this effect is 0.4445 μg/mL, corresponding to a specific activity is 2.249×103 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q00987 (S17-N111)

Gene ID

4193

Molecular Construction
N-term
MDM2 (S17-N111)
Accession # Q00987
C-term
Synonyms
MDM2; E3 ubiquitin-protein ligase Mdm2; Double minute 2 protein; Hdm2; Oncoprotein Mdm2; RING-type E3 ubiquitin transferase Mdm2; p53-binding protein Mdm2
AA Sequence

SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN

Molecular Weight

Approximately 11.1-12 KDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol, 1mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDM2 Protein, Human
Cat. No.:
HY-P701593
Quantity:
MCE Japan Authorized Agent: