MecA Protein, S. aureus (His-SUMO)

The MecA protein plays a crucial role in cellular machinery by facilitating the recognition and targeting of unfolded and aggregated proteins, directing them to the ClpC protease or other proteins involved in proteolysis. The function of this protein is critical for the efficient removal and degradation of abnormal proteins, ensuring cellular homeostasis and preventing the accumulation of potentially harmful protein aggregates. MecA Protein, S. aureus (His-SUMO) is the recombinant Staphylococcus aureus-derived MecA protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of MecA Protein, S. aureus (His-SUMO) is 239 a.a., with molecular weight of ~44.3 kDa.

The MecA protein, characterized by its homodimeric structure, serves a pivotal role in cellular protein quality control. Its primary function involves the recognition and precise targeting of unfolded and aggregated proteins, directing them either to the ClpC protease or to other proteins participating in proteolysis. Through its homodimeric configuration, MecA demonstrates a remarkable ability to engage with a diverse array of substrates, orchestrating their efficient degradation within the cellular proteolytic network. This process is integral for maintaining cellular integrity by preventing the accumulation of misfolded or aggregated proteins that could otherwise compromise cellular functions. The MecA protein thus stands as a key player in cellular proteostasis, ensuring the timely removal of aberrant proteins to safeguard overall cellular health. (

Staphylococcus aureus

E. coli

N-His;N-SUMO

P60186 (1M-239E)

/

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE

Approximately 44.3 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.