MESDC2 Protein, Human (HEK293, His)

The MESDC2 protein acts as a chaperone and plays a specific role in promoting the folding of the β-propeller/EGF module within the low-density lipoprotein receptor (LDLR) family.In addition to participating in LDLR folding, MESDC2 acts as an important regulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, thereby affecting Wnt signaling.MESDC2 Protein, Human (HEK293, His) is the recombinant human-derived MESDC2 protein, expressed by HEK293 , with C-His labeled tag.

MESDC2 protein serves as a chaperone with specific roles in facilitating the folding of beta-propeller/EGF modules within the low-density lipoprotein receptor (LDLR) family. Beyond its involvement in LDLR folding, MESDC2 acts as a crucial modulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, influencing Wnt signaling (PubMed:17488095). In embryonic development, MESDC2 plays an essential role in specifying polarity and inducing mesoderm formation. Additionally, it contributes significantly to neuromuscular junction (NMJ) formation by promoting the cell-surface expression of LRP4 (By similarity). The protein may also regulate the phagocytosis of apoptotic retinal pigment epithelium (RPE) cells (By similarity). As a monomer, MESDC2 interacts with LRP5 and LRP6, preventing their aggregation and guiding them to the plasma membrane. Furthermore, MESDC2 interacts with LRP4, promoting glycosylation and cell-surface expression of LRP4 (By similarity).

Human

HEK293

C-6*His

Q14696-1 (A34-K230)

23184  [NCBI]

AEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK

Approximately 27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.