MFAP3 Protein, Human (HEK293, Fc)

MFAP3 (microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cell structure. As a component of elastin-related microfibrils, it is essential in providing structural integrity and elasticity to various tissues in the body. MFAP3 Protein, Human (HEK293, Fc) is the recombinant human-derived MFAP3 protein, expressed by HEK293 , with C-hFc labeled tag.

MFAP3 (Microfibril-associated protein 3) is a protein that plays a crucial role in maintaining cellular architecture. It functions as a component of elastin-associated microfibrils, which are essential for providing structural integrity and elasticity to various tissues in the body. By being involved in the formation and organization of these microfibrils, MFAP3 contributes to the overall stability and functionality of tissues that require elasticity, such as blood vessels, skin, and lungs. Understanding the role of MFAP3 can provide insights into the mechanisms underlying tissue development, maintenance, and potential diseases related to abnormalities in cellular architecture.

Human

HEK293

C-hFc

P55082-1 (A19-M147)

4238  [NCBI]

AFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDM

Approximately 55-70 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.