MFAP4 Protein, Mouse (HEK293, His-Flag)

MFAP4 Protein participates in calcium-dependent cell adhesion or intercellular interactions and may contribute to elastic fiber assembly and maintenance. It forms homodimers and higher oligomers, interacting with FBN1, FBN2, LOX, COL1A1, and ELN in a calcium-dependent manner, promoting ELN self-assembly. MFAP4 Protein, Mouse (HEK293, His-Flag) is the recombinant mouse-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag. The total length of MFAP4 Protein, Mouse (HEK293, His-Flag) is 235 a.a., with molecular weight of 35-40 kDa.

MFAP4 protein is implicated in potential roles related to calcium-dependent cell adhesion or intercellular interactions. It is suggested to play a role in the assembly and/or maintenance of elastic fibers, contributing to the dynamic processes associated with these structures. MFAP4 can form homodimers and higher-order oligomers, and it interacts with proteins such as FBN1, FBN2, LOX, COL1A1, and ELN in a calcium-dependent manner. Notably, its interaction with ELN promotes the self-assembly of elastin, emphasizing its involvement in structural processes associated with extracellular matrix components.

Mouse

HEK293

N-His;N-Flag

Q9D1H9-1(Q23-A257)

76293  [NCBI]

QASGIRGDALEKSCLQQPLDCDDIYAQGYQEDGVYLIYPYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWSDYKLGFGRADGEYWLGLQNLHLLTLKQKYELRVDLEDFENNTAYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

35-40 kDa

Greater than 95% as determined by Tris-Bis PAGE

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.