1. Recombinant Proteins
  2. CD Antigens
  3. Monocyte CD Proteins
  4. CD301/CLEC10A
  5. MGL2/CD301b Protein, Mouse (HEK293, His)

MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293, with N-6*His labeled tag. The total length of MGL2/CD301b Protein, Mouse (HEK293, His) is 261 a.a., with molecular weight of 30-40 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MGL2/CD301b is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. MGL2/CD301b Protein, Mouse (HEK293, His) is the recombinant mouse-derived MGL2/CD301b protein, expressed by HEK293, with N-6*His labeled tag. The total length of MGL2/CD301b Protein, Mouse (HEK293, His) is 261 a.a., with molecular weight of 30-40 kDa.

Background

Macrophage Gal/GalNAc lectin 2 (MGL2 or CD301) is a type II lectin commonly used as a marker for alternatively activated macrophages. MGL2 can bind to terminal GalNAc residues, including the Tn antigen (GalNAc-αThr/Ser). MGL2 is mainly expressed on immature, tolerogenic or type-2 DCs and alternatively-activated macrophages[1][2]. Besides, murine MGL2 interacts strongly to adenocarcinoma cells, indicating the role in tumor immunity[3].

Species

Mouse

Source

HEK293

Tag

N-6*His

Accession

Q8JZN1 (S72-P332)

Gene ID

216864  [NCBI]

Molecular Construction
N-term
6*His
MGL2 (S72-P332)
Accession # Q8JZN1
C-term
Synonyms
Mgl2; CD301b; Macrophage galactose N-acetyl-galactosamine-specific lectin 2; Macrophage Galactose-type C-lectin 2
AA Sequence

SQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDVEDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICETELGKASSAHSPQLIASVP

Molecular Weight

30-40 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MGL2/CD301b Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MGL2/CD301b Protein, Mouse (HEK293, His)
Cat. No.:
HY-P70874
Quantity:
MCE Japan Authorized Agent: