MIA Protein, Human (N-His)

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (N-His) is the recombinant human-derived MIA protein, expressed by E. coli , with N-6*His labeled tag. The total length of MIA Protein, Human (N-His) is 107 a.a., with molecular weight of ~14.0 kDa.

Melanoma Inhibitory Activity (MIA) is a protein known for its growth-inhibitory effects on melanoma cells in vitro and displays similar actions on various neuroectodermal tumors, such as gliomas. MIA's ability to elicit growth inhibition suggests its potential role as a tumor suppressor, particularly in the context of malignancies originating from neuroectodermal tissues. Additionally, MIA interacts with FASLG, indicating its involvement in cellular processes related to apoptosis and immune response. Furthermore, its interaction with TMIGD2 suggests a potential role in modulating signaling pathways or cellular adhesion. The multifaceted interactions and growth-inhibitory properties of MIA highlight its significance in the regulation of tumor growth and its potential therapeutic relevance in neuroectodermal cancers.

Measured in a cell proliferation assay using human A375 melanoma cell line.The ED₅₀ for this effect is 4-8 μg/mL, corresponding to a specific activity is 135-244 units/mg.

• 
  Measured in a cell proliferation assay using human A375 melanoma cell line.The ED₅₀ for this effect is 4-8 μg/mL, corresponding to a specific activity is 135-244 units/mg.

Human

E. coli

N-6*His

Q16674 (G25-Q131)

8190  [NCBI]

GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Approximately 14.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.