MIF Protein, Human (His, solution)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) MIF Protein, Human (His, solution) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

MIF Protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens. Its expression at sites of inflammation suggests its involvement in regulating macrophage function in host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, the physiological substrate of MIF is still unknown. It remains unclear whether the tautomerase activity is relevant to its cytokine activity.

Human

E. coli

N-6*His

P14174 (M1-A115)

4282  [NCBI]

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

10-14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl,50% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.