MIF Protein, Human (N-His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (N-His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag. The total length of MIF Protein, Human (N-His) is 115 a.a., with molecular weight of approximately 11.67 kDa.

MIF Protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens. Its expression at sites of inflammation suggests its involvement in regulating macrophage function in host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, the physiological substrate of MIF is still unknown. It remains unclear whether the tautomerase activity is relevant to its cytokine activity.

Measured by its ability to inhibit THP-1 human acute monocyte migration. The ED₅₀ this effect is 2.318 ng/mL, corresponding to a specific activity is 4.314×10⁵ U/mg.

Human

E. coli

N-6*His

P14174 (M1-A115)

4282  [NCBI]

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

approximately 11.67 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.