2. Recombinant Proteins
  3. Others
  4. Minor allergen Can f 2 protein, Dog (His-SUMO)

Minor allergen Can f 2 protein, Dog (His-SUMO)

Cat. No.: HY-P71525
Handling Instructions

The Minor allergen Can f 2 protein is found in tongue epithelial tissue and the parotid gland. Minor allergen Can f 2 protein, Dog (His-SUMO) is the recombinant dog-derived Minor allergen Can f 2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Minor allergen Can f 2 protein is found in tongue epithelial tissue and the parotid gland. Minor allergen Can f 2 protein, Dog (His-SUMO) is the recombinant dog-derived Minor allergen Can f 2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background

The Minor allergen Can f 2 protein is localized in tongue epithelial tissue and the parotid gland.
Species

Dog
Source

E. coli
Tag

N-His;N-SUMO
Accession

O18874 (Q19-D180)
Gene ID

403829  [NCBI]
Molecular Construction
N-term
6*His-SUMO
Can f 2 (Q19-D180)
Accession # O18874
C-term
Synonyms
Minor allergen Can f 2; Allergen Dog 2; allergen Can f 2
AA Sequence

QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD

Molecular Weight

Approximately 34.4 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

Minor allergen Can f 2 protein, Dog (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Minor allergen Can f 2 protein, Dog (His-SUMO)
Cat. No.:
HY-P71525
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.