MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO)

MIP-3 alpha/CCL20 Protein acts as a ligand for CCR6, inducing a potent chemotactic response and intracellular calcium mobilization upon CCR6 binding. Crucial in chemotaxis, the CCL20-CCR6 pair attracts dendritic cells, effector/memory T-cells, and B-cells, especially in skin and mucosal surfaces during homeostasis, inflammation, cancer, and autoimmune diseases. As a chemotactic factor, CCL20 selectively attracts lymphocytes, less so neutrophils, excluding monocytes. It recruits pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to inflammation sites and is essential for optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Additionally, it positively regulates sperm motility and chemotaxis by binding to CCR6, triggering Ca2+ mobilization in sperm for motility. CCL20 may contribute to the formation and function of mucosal lymphoid tissues by directing lymphocytes and dendritic cells to epithelial cells. MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is the recombinant bovine-derived MIP-3 alpha/CCL20 protein, expressed by E. coli, with N-SUMO, N-6*His labeled tag. The total length of MIP-3 alpha/CCL20 Protein, Bovine (His-SUMO) is 70 a.a., with molecular weight of 24.1 kDa.

MIP-3 alpha/CCL20 Protein serves as a ligand for C-C chemokine receptor CCR6, initiating a potent chemotactic response and mobilizing intracellular calcium ions upon CCR6 binding and activation. The CCL20-CCR6 ligand-receptor pair plays a crucial role in chemotaxis, attracting dendritic cells (DC), effector/memory T-cells, and B-cells. This partnership is particularly significant in skin and mucosal surfaces under various conditions, including homeostasis, inflammation, cancer, and autoimmune diseases. Acting as a chemotactic factor, CCL20 specifically attracts lymphocytes and, to a lesser extent, neutrophils, excluding monocytes. Furthermore, it is involved in recruiting both pro-inflammatory IL17-producing helper T-cells (Th17) and regulatory T-cells (Treg) to inflammation sites. CCL20 is essential for the optimal migration of thymic natural regulatory T cells (nTregs) and DN1 early thymocyte progenitor cells. Additionally, it positively regulates sperm motility and chemotaxis by binding to CCR6, triggering Ca2+ mobilization in sperm, a crucial factor for motility. CCL20 may also contribute to the formation and function of mucosal lymphoid tissues by directing lymphocytes and dendritic cells towards epithelial cells.

Bovine

E. coli

N-SUMO;N-6*His

Q8SQB1 (A27-M96)

281666  [NCBI]

ASNFDCCLRYTERILHPSILVGFTQQLANEACDINAVVFYTRKKLAVCADPKKKWVKQVVHMLSQRVKRM

24.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.