1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL18
  6. MIP-4/CCL18 Protein, Human (P. pastoris, His)

MIP-4/CCL18 Protein, Human (P. pastoris, His)

Cat. No.: HY-P700545
Handling Instructions Technical Support

The MIP-4/CCL18 protein selectively attracts lymphocytes, but not monocytes or granulocytes. It participates in the migration of B cells to follicles in lymph nodes and coordinates immune cell dynamics. MIP-4/CCL18 Protein, Human (P. pastoris, His) is the recombinant human-derived MIP-4/CCL18 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of MIP-4/CCL18 Protein, Human (P. pastoris, His) is 69 a.a., with molecular weight of 9.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MIP-4/CCL18 protein selectively attracts lymphocytes, but not monocytes or granulocytes. It participates in the migration of B cells to follicles in lymph nodes and coordinates immune cell dynamics. MIP-4/CCL18 Protein, Human (P. pastoris, His) is the recombinant human-derived MIP-4/CCL18 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of MIP-4/CCL18 Protein, Human (P. pastoris, His) is 69 a.a., with molecular weight of 9.9 kDa.

Background

MIP-4/CCL18 protein functions as a chemotactic factor with a specific affinity for lymphocytes, excluding monocytes or granulocytes. Its potential involvement in B-cell migration into B-cell follicles within lymph nodes suggests a role in orchestrating the cellular dynamics of immune responses. Furthermore, MIP-4/CCL18 plays a crucial role in attracting naive T-lymphocytes towards dendritic cells and activated macrophages in lymph nodes, exhibiting chemotactic activity for various T-cell subtypes, including naive T-cells, CD4+, and CD8+ T-cells. This broad chemotactic influence positions MIP-4/CCL18 as a potential player in both humoral and cell-mediated immunity responses, underscoring its multifaceted role in modulating immune cell trafficking and interactions within lymphoid tissues.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P55774 (A21-A89)

Gene ID
Molecular Construction
N-term
6*His
CCL18 (A21-A89)
Accession # P55774
C-term
Synonyms
rHuMIP-4/CCL18; C-C motif chemokine 18; AMAC-1; SCYA18
AA Sequence

AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Molecular Weight

9.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MIP-4/CCL18 Protein, Human (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MIP-4/CCL18 Protein, Human (P. pastoris, His)
Cat. No.:
HY-P700545
Quantity:
MCE Japan Authorized Agent: