MMP-2 Protein, Mouse (HEK293, His)

MMP-2 protein is a ubiquitous metalloprotease that contributes to vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to extracellular matrix degradation, it also targets non-matrix proteins and promotes vasoconstriction. MMP-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-2 protein, expressed by HEK293 , with N-His labeled tag.

MMP-2 protein is a versatile ubiquitinous metalloproteinase with involvement in various functions, including vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Apart from its role in degrading extracellular matrix proteins, it also acts on nonmatrix proteins such as big endothelial 1 and beta-type CGRP, promoting vasoconstriction. Furthermore, it cleaves KISS at a Gly-|-Leu bond and appears to play a role in myocardial cell death pathways and myocardial oxidative stress regulation by influencing GSK3beta activity. Additionally, MMP-2 is implicated in the formation of fibrovascular tissues and its C-terminal non-catalytic fragment, PEX, exhibits anti-angiogenic and anti-tumor properties while inhibiting cell migration and adhesion to FGF2 and vitronectin. Furthermore, MMP-2 serves as a ligand for integrin alpha-v/beta-3 on the surface of blood vessels.

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 4214 pmol/min/µg, as measured under the described conditions.

Mouse

HEK293

N-His

NP_032636.1 (M409-C662)

17390  [NCBI]

MGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Approximately 34.54 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 (Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.) or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.