1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-2
  5. MMP-2 Protein, Rat (P. pastoris, His)

MMP-2 is a multifunctional metalloproteinase that plays multiple roles in vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, MMP-2 also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Rat (P. pastoris, His) is the recombinant rat-derived MMP-2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of MMP-2 Protein, Rat (P. pastoris, His) is 553 a.a., with molecular weight of 64.1 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-2 is a multifunctional metalloproteinase that plays multiple roles in vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, MMP-2 also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Rat (P. pastoris, His) is the recombinant rat-derived MMP-2 protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of MMP-2 Protein, Rat (P. pastoris, His) is 553 a.a., with molecular weight of 64.1 kDa.

Background

MMP-2, a ubiquitinous metalloproteinase, plays a multifaceted role in diverse biological processes, encompassing vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Beyond its conventional role in degrading extracellular matrix proteins, MMP-2 exhibits versatility by acting on non-matrix proteins like big endothelial 1 and beta-type CGRP, thereby promoting vasoconstriction. Additionally, it cleaves KISS at a Gly-|-Leu bond and appears implicated in myocardial cell death pathways, contributing to myocardial oxidative stress through the regulation of GSK3beta activity, which it cleaves in vitro. Remarkably, the C-terminal non-catalytic fragment of MMP-2, known as PEX, possesses anti-angiogenic and anti-tumor properties, inhibiting cell migration and adhesion to FGF2 and vitronectin while serving as a ligand for integrin alpha-v/beta3 on the surface of blood vessels.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Rat

Source

P. pastoris

Tag

N-6*His

Accession

P33436 (Y110-C662)

Gene ID
Molecular Construction
N-term
6*His
MMP-2 (Y110-C662)
Accession # P33436
C-term
Synonyms
rHu72 kDa type IV collagenase/MMP-2, His ; 72 kDa Type IV Collagenase; 72 kDa Gelatinase; Gelatinase A; Matrix Metalloproteinase-2; MMP-2; TBE-1; MMP2; CLG4A
AA Sequence

YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Molecular Weight

67 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MMP-2 Protein, Rat (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-2 Protein, Rat (P. pastoris, His)
Cat. No.:
HY-P700573
Quantity:
MCE Japan Authorized Agent: