MMP-7 Protein, Rat (P. pastoris, His)

The MMP-7 protein is an enzyme with multifunctional substrate-degrading capabilities, acting on casein, gelatin (types I, III, IV, and V) and fibronectin.As a multifunctional matrix metalloproteinase, MMP-7 contributes to tissue remodeling and renewal, including procollagenase activation, demonstrating its role in the regulation of collagen metabolism.MMP-7 Protein, Rat (P.pastoris, His) is the recombinant rat-derived MMP-7 protein, expressed by P.pastoris , with N-6*His labeled tag.

The MMP-7 protein serves as an enzyme with the capacity to degrade various substrates, including casein, gelatins of types I, III, IV, and V, and fibronectin. This multifunctional matrix metalloproteinase exhibits proteolytic activity that contributes to tissue remodeling and turnover. Additionally, MMP-7 plays a role in the activation of procollagenase, reflecting its involvement in the regulation of collagen metabolism. The diverse substrate specificity of MMP-7 highlights its importance in modulating the extracellular matrix and influencing cellular processes associated with tissue homeostasis, repair, and development.

Measured by its ability to cleave 60μM fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is 223.769 pmol/min/µg, as measured under the described conditions.

Rat

P. pastoris

N-6*His

P50280 (F98-L267)

25335  [NCBI]

FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

30 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.