1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-7
  5. MMP-7 Protein, Rat (P. pastoris, His)

The MMP-7 protein is an enzyme with multifunctional substrate-degrading capabilities, acting on casein, gelatin (types I, III, IV, and V) and fibronectin.As a multifunctional matrix metalloproteinase, MMP-7 contributes to tissue remodeling and renewal, including procollagenase activation, demonstrating its role in the regulation of collagen metabolism.MMP-7 Protein, Rat (P.pastoris, His) is the recombinant rat-derived MMP-7 protein, expressed by P.pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MMP-7 protein is an enzyme with multifunctional substrate-degrading capabilities, acting on casein, gelatin (types I, III, IV, and V) and fibronectin.As a multifunctional matrix metalloproteinase, MMP-7 contributes to tissue remodeling and renewal, including procollagenase activation, demonstrating its role in the regulation of collagen metabolism.MMP-7 Protein, Rat (P.pastoris, His) is the recombinant rat-derived MMP-7 protein, expressed by P.pastoris , with N-6*His labeled tag.

Background

The MMP-7 protein serves as an enzyme with the capacity to degrade various substrates, including casein, gelatins of types I, III, IV, and V, and fibronectin. This multifunctional matrix metalloproteinase exhibits proteolytic activity that contributes to tissue remodeling and turnover. Additionally, MMP-7 plays a role in the activation of procollagenase, reflecting its involvement in the regulation of collagen metabolism. The diverse substrate specificity of MMP-7 highlights its importance in modulating the extracellular matrix and influencing cellular processes associated with tissue homeostasis, repair, and development.

Biological Activity

Measured by its ability to cleave 60μM fluorogenic peptide substrate Mca-KPLGL-Dpa-AR-NH2. The specific activity is 223.769 pmol/min/µg, as measured under the described conditions.

Species

Rat

Source

P. pastoris

Tag

N-6*His

Accession

P50280 (F98-L267)

Gene ID
Molecular Construction
N-term
6*His
MMP-7 (F98-L267)
Accession # P50280
C-term
Synonyms
Matrilysin; Matrin; Matrix metalloproteinase-7; Pump-1 protease; MPSL1; PUMP1
AA Sequence

FSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL

Molecular Weight

30 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MMP-7 Protein, Rat (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-7 Protein, Rat (P. pastoris, His)
Cat. No.:
HY-P700574
Quantity:
MCE Japan Authorized Agent: