1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-9
  5. MMP-9 Protein, Human (HEK293, His, solution)

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MMP-9 protein is a matrix metalloproteinase that is critical for local extracellular matrix proteolysis and leukocyte migration. It is suggested that it may be involved in bone osteoclastic resorption. MMP-9 Protein, Human (HEK293, His, solution) is the recombinant human-derived MMP-9 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MMP-9 Protein, a matrix metalloproteinase, plays a crucial role in local proteolysis of the extracellular matrix and facilitates leukocyte migration. It could be involved in bone osteoclastic resorption and cleaves KiSS1 at a specific Gly-|-Leu bond. Additionally, MMP-9 cleaves NINJ1 to generate the Secreted ninjurin-1 form and processes type IV and type V collagen into large C-terminal three-quarter fragments and shorter N-terminal one-quarter fragments. While degrading fibronectin, MMP-9 does not impact laminin or Pz-peptide, showcasing its selectivity in substrate cleavage.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate 20 μM Mca-PLGL-Dpa-AR-NH2(HY-131498)that incubate at room temperature in kinetic mode for 5 minutes.The specific activity is ≥80000 pmol/min/µg. (The proenzyme needs to be activated by APMA for an activated form.)

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH06093.1 (A19-D707)

Gene ID
Molecular Construction
N-term
MMP-9 (A19-D707)
Accession # AAH06093.1
6*His
C-term
Synonyms
rHuMatrix metalloproteinase-9/MMP-9, His; Matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; MMP9
AA Sequence

AAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Molecular Weight

Approximately 90.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 2 mM CaCl2, 150 mM NaCl, 0.05% Brij35(w/v), pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MMP-9 Protein, Human (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-9 Protein, Human (HEK293, His, solution)
Cat. No.:
HY-P70145
Quantity:
MCE Japan Authorized Agent: