1. Recombinant Proteins
  2. Others
  3. MOB4 Protein, Human (His)

The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MOB4 protein may be involved in membrane trafficking, specifically the membrane budding reaction, highlighting its role in vesicle formation and trafficking.MOB4 interacts with STRN4, suggesting involvement in protein-protein interactions.MOB4 Protein, Human (His) is the recombinant human-derived MOB4 protein, expressed by E.coli , with N-6*His labeled tag.

Background

The MOB4 protein is suggested to potentially play a role in membrane trafficking, with a specific involvement in membrane budding reactions, indicating its significance in cellular processes related to vesicle formation and transport. Functionally, MOB4 has been identified to bind STRN4, suggesting a potential role in protein-protein interactions crucial for its cellular functions. Additionally, MOB4 interacts with DNM1 and EPS15, further highlighting its involvement in dynamic cellular processes associated with membrane dynamics. Moreover, MOB4 forms part of a ternary complex containing STRN and/or STRN3 and PPA2, indicating its participation in multi-protein complexes that may regulate membrane-related activities. The protein also interacts with nucleoside diphosphate kinase and binds STRN and STRN3, underscoring its versatility in engaging with various molecular partners. Furthermore, MOB4 interacts with CTTNBP2 and CTTNBP2NL, emphasizing its potential role in diverse cellular pathways and the intricate regulation of membrane-associated events. The detailed molecular interactions and specific functions of MOB4 in membrane trafficking warrant further exploration.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y3A3 (M1-A225)

Gene ID
Molecular Construction
N-term
6*His
MOB4 (M1-A225)
Accession # Q9Y3A3
C-term
Synonyms
MOB-Like Protein Phocein; 2C4D; Class II mMOB1; Mob1 Homolog 3; Mob3; Mps One Binder Kinase Activator-Like 3; Preimplantation Protein 3; MOB4; MOB3; MOBKL3; PHOCN; PREI3
AA Sequence

MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA

Molecular Weight

Approximately 29.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

MOB4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MOB4 Protein, Human (His)
Cat. No.:
HY-P70940
Quantity:
MCE Japan Authorized Agent: