1. Recombinant Proteins
  2. Others
  3. MORF4L2 Protein, Human (His)

The MORF4L2 protein is an important component of the NuA4 histone acetyltransferase complex and promotes transcriptional activation by acetylating histones H4 and H2A. This modification alters nucleosome-DNA interactions and promotes interactions with other transcription-positive proteins. MORF4L2 Protein, Human (His) is the recombinant human-derived MORF4L2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of MORF4L2 Protein, Human (His) is 288 a.a., with molecular weight of 33-36 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MORF4L2 protein is an important component of the NuA4 histone acetyltransferase complex and promotes transcriptional activation by acetylating histones H4 and H2A. This modification alters nucleosome-DNA interactions and promotes interactions with other transcription-positive proteins. MORF4L2 Protein, Human (His) is the recombinant human-derived MORF4L2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of MORF4L2 Protein, Human (His) is 288 a.a., with molecular weight of 33-36 kDa.

Background

MORF4L2 protein serves as an integral component of the NuA4 histone acetyltransferase complex, contributing to the transcriptional activation of select genes through the acetylation of nucleosomal histones H4 and H2A. This modification not only alters nucleosome-DNA interactions but also facilitates the interaction of modified histones with other proteins that positively regulate transcription. The NuA4 complex, where MORF4L2 plays a vital role, is implicated in diverse cellular processes, including growth induction, growth arrest, replicative senescence, apoptosis, and DNA repair. RUVBL1 and RUVBL2 associate with EP400 to contribute ATPase and helicase activities to the NuA4 complex. MORF4L2 is also a component of the MSIN3A complex, which functions in transcriptional repression through the deacetylation of nucleosomal histones. Within the NuA4 complex, MORF4L2 interacts with various subunits, including KAT5/TIP60, EP400, TRRAP/PAF400, and others. Moreover, MORF4L2 is part of the MSIN3A histone deacetylase complex, collaborating with SIN3A, HDAC2, ARID4B, MORF4L1, RBBP4/RbAp48, and RBBP7/RbAp46. Its interactions with MRFAP1 and RB1, along with potential associations with the TLE family of transcriptional repressors, underscore MORF4L2's intricate involvement in chromatin modification and gene regulation.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q15014 (M1-L288)

Gene ID
Molecular Construction
N-term
MORF4L2 (M1-L288)
Accession # Q15014
6*His
C-term
Synonyms
Mortality Factor 4-Like Protein 2; MORF-Related Gene X Protein; Protein MSL3-2; Transcription Factor-Like Protein MRGX; MORF4L2; KIAA0026; MRGX
AA Sequence

MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL

Molecular Weight

33-36 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MORF4L2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MORF4L2 Protein, Human (His)
Cat. No.:
HY-P70839
Quantity:
MCE Japan Authorized Agent: