1. Recombinant Proteins
  2. Others
  3. MUC-17 Protein, Human (HEK293, His)

MUC-17 protein maintains mucosal homeostasis, contributing to environmental stability. Interacting via its C-terminus, MUC-17 crucially associates with PDZK1, ensuring proper cellular localization. MUC-17 Protein, Human (HEK293, His) is the recombinant human-derived MUC-17 protein, expressed by HEK293, with C-His labeled tag. The total length of MUC-17 Protein, Human (HEK293, His) is 260 a.a., with molecular weight of ~20-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MUC-17 protein maintains mucosal homeostasis, contributing to environmental stability. Interacting via its C-terminus, MUC-17 crucially associates with PDZK1, ensuring proper cellular localization. MUC-17 Protein, Human (HEK293, His) is the recombinant human-derived MUC-17 protein, expressed by HEK293, with C-His labeled tag. The total length of MUC-17 Protein, Human (HEK293, His) is 260 a.a., with molecular weight of ~20-35 kDa.

Background

MUC-17 protein likely functions in maintaining homeostasis on mucosal surfaces, contributing to the stability and equilibrium of these environments. Through interactions facilitated by its C-terminus, MUC-17 engages with PDZK1, and this association is crucial for its proper localization within the cellular context.

Biological Activity

Immobilized  Human MUC-17 at 2 μg/mL (100 μL/well) can bind Anti- MUC-17 Antibody, The  ED50 for this effect is ≤11.32 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q685J3-1 (R4131-L4390)

Gene ID
Molecular Construction
N-term
MUC-17 (R4131-L4390)
Accession # Q685J3-1
His
C-term
Synonyms
Mucin-17; MUC-17; MUC17; MUC-3; MUC3
AA Sequence

RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL

Molecular Weight

Approximately 20-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MUC-17 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MUC-17 Protein, Human (HEK293, His)
Cat. No.:
HY-P78744
Quantity:
MCE Japan Authorized Agent: