Murinoglobulin-1/Mug1 Protein, Mouse (His)

Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.

Murinoglobulin-1 (Mug1) operates as a proteinase inhibitor through a specific proteolytic activation mechanism in the bait region. This activation triggers a reaction at the cysteinyl-glutamyl internal thiol ester site, leading to a conformational change that effectively traps or covalently binds the proteinase to the inhibitor. In tetrameric forms of this proteinase inhibitor, steric hindrance alone provides robust inhibition. However, in monomeric configurations, an additional covalent linkage is essential between the activated glutamyl residue and a terminal amino group of a lysine or another nucleophilic group on the proteinase for inhibition to be fully effective. This intricate process highlights Mug1's ability to modulate proteinase activity through a combination of structural and chemical interactions.

Mouse

E. coli

N-6*His

P28665 (700T-910E)

17836  [NCBI]

TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE

Approximately 32.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCI, 1 mM EDTA, 6% Trehalose, pH 8.0

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.