1. Recombinant Proteins
  2. Others
  3. MutT Protein, E.coli (His-SUMO)

The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MutT protein maintains the genome by hydrolyzing 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. Integrity plays a key role. This prevents misincorporation of 8-oxoGua into DNA and RNA, ensuring the fidelity of the nucleotide library. MutT Protein, E.coli (His-SUMO) is the recombinant E. coli-derived MutT protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

MutT protein plays a pivotal role in maintaining genomic integrity by specifically hydrolyzing both 8-oxo-deoxyguanosine triphosphate (8-oxo-dGTP) and 8-oxo-guanosine triphosphate (8-oxo-GTP) to their corresponding monophosphates. This enzymatic activity is crucial for preventing the misincorporation of 8-oxoGua into DNA and RNA, thereby ensuring the fidelity of nucleotide pools. MutT's ability to remove oxidatively damaged guanine, specifically 8-oxo-dGTP, from DNA and nucleotide pools prevents replicational errors, particularly A.T to G.C transversions. Additionally, MutT may contribute to transcriptional fidelity by cleaning up 8-oxo-GTP from the ribonucleotide triphosphate pool, although its impact on transcriptional fidelity is likely limited due to the lower efficiency of RNA polymerase in incorporating 8-oxo-GTP. Furthermore, MutT demonstrates versatility by hydrolyzing 8-oxo-dGDP and 8-oxo-GDP to their monophosphate forms and can, to a lesser extent, process various nucleoside di- and triphosphates. Collaborating with MutM and MutY, MutT acts cooperatively to prevent the accumulation of oxidized guanine residues in DNA, highlighting its essential role in maintaining the integrity of the genetic material.

Species

E.coli

Source

E. coli

Tag

N-His;N-SUMO

Accession

P08337 (M1-L129)

Gene ID

944824  [NCBI]

Molecular Construction
N-term
6*His-SUMO
MutT (M1-L129)
Accession # P08337
C-term
Synonyms
mutT; b0099; JW0097; 8-oxo-dGTP diphosphatase; 8-oxo-dGTPase; EC 3.6.1.55; 7,8-dihydro-8-oxoguanine-triphosphatase; Mutator protein MutT; dGTP pyrophosphohydrolase
AA Sequence

MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL

Molecular Weight

Approximately 30.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MutT Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MutT Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71482
Quantity:
MCE Japan Authorized Agent: