MZB1/PERP1 Protein, Human (HEK293, His)

MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.

The MZB1/PERP1 Protein associates with immunoglobulin M (IgM) heavy and light chains, facilitating the assembly and secretion of IgM. Its influence may stem from its role as a molecular chaperone or an oxidoreductase, given its demonstrated low level of oxidoreductase activity (By similarity). Isoform 2 potentially participates in the regulation of apoptosis. Moreover, MZB1/PERP1 contributes to the diversification of peripheral B-cell functions by overseeing Ca(2+) stores, antibody secretion, and integrin activation. Acting as a hormone-regulated adipokine and pro-inflammatory cytokine, it is implicated in chronic inflammation, influencing cellular expansion and blunting insulin response in adipocytes. Additionally, MZB1/PERP1 may play a role in the onset of insulin resistance.

Human

HEK293

C-His

Q8WU39-1 (D23-T185)

51237  [NCBI]

DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT

Approximately 19-23 kDa due to glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.