1. Recombinant Proteins
  2. Others
  3. NAGA Protein, Human (HEK293, His)

NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag. The total length of NAGA Protein, Human (HEK293, His) is 394 a.a., with molecular weight of 47-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag. The total length of NAGA Protein, Human (HEK293, His) is 394 a.a., with molecular weight of 47-65 kDa.

Background

NAGA protein serves a pivotal role in cellular metabolism by catalyzing the removal of terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzymatic activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic processes within the cell. NAGA's capacity to cleave these specific residues underscores its significance in regulating glycolipid degradation, reflecting its importance in maintaining cellular homeostasis and proper functioning.

Species

Human

Source

HEK293

Tag

C-His

Accession

P17050 (L18-Q411)

Gene ID
Molecular Construction
N-term
NAGA (L18-Q411)
Accession # P17050
His
C-term
Synonyms
Alpha-N-acetylgalactosaminidase; Alpha-galactosidase B; NAGA
AA Sequence

LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

Molecular Weight

Approximately 47-65 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NAGA Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NAGA Protein, Human (HEK293, His)
Cat. No.:
HY-P73753
Quantity:
MCE Japan Authorized Agent: