1. Recombinant Proteins
  2. Cytokines and Growth Factors Others
  3. Peptide Hormone & Neuropeptides
  4. Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His)

Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His)

Cat. No.: HY-P700563
Handling Instructions Technical Support

Natriuretic peptide A/NPPA is critical for cardiorenal homeostasis and regulates vascular remodeling and energy metabolism by binding to NPR1. This stimulates the production of c, activating PRKG1 to respond differently. Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is the recombinant human-derived Natriuretic peptides A/NPPA protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is 38 a.a., with molecular weight of 5.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Natriuretic peptide A/NPPA is critical for cardiorenal homeostasis and regulates vascular remodeling and energy metabolism by binding to NPR1. This stimulates the production of c, activating PRKG1 to respond differently. Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is the recombinant human-derived Natriuretic peptides A/NPPA protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) is 38 a.a., with molecular weight of 5.9 kDa.

Background

Natriuretic peptides A/NPPA, vital in cardio-renal homeostasis, play diverse roles in vascular remodeling and energy metabolism. These peptides bind and stimulate NPR1, triggering cGMP production and activating downstream effectors, including PRKG1, to mediate various biological responses. Functionally, they regulate vasodilation, natriuresis, diuresis, and aldosterone synthesis, crucial for blood pressure regulation and fluid-electrolyte balance. In addition, they inhibit cardiac remodeling and hypertrophy by inducing cardiomyocyte apoptosis and restraining cell growth. During pregnancy, Natriuretic peptides A/NPPA promote trophoblast invasion and spiral artery remodeling, preventing pregnancy-induced hypertension. In adipose tissue, they regulate lipid metabolism and energy homeostasis through cGMP- and PKG-dependent pathways, influencing AMP-activated protein kinase (AMPK) and promoting UCP1-dependent thermogenesis in brown adipose tissue. The interaction with clearance receptor NPR3 contributes to their removal from circulation. While reports on their involvement in mammalian blood volume and pressure homeostasis vary, they enhance urine protein excretion by reducing proximal tubular protein reabsorption. Overall, Natriuretic peptides A/NPPA emerge as key players in maintaining physiological balance across multiple systems.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

P01160 (P78-L115)

Gene ID
Molecular Construction
N-term
6*His
NPPA (P78-L115)
Accession # P01160
C-term
Synonyms
NPPA; natriuretic peptide A; ANP, natriuretic peptide precursor A , PND; natriuretic peptides A; atriopeptin; cardionatrin; prepronatriodilatin; natriuretic peptide precursor A; ANF; ANP; PND; ATFB6; CDD-ANF;
AA Sequence

PEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKL

Molecular Weight

5.9 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Natriuretic peptides A/NPPA Protein, Human (P. pastoris, His)
Cat. No.:
HY-P700563
Quantity:
MCE Japan Authorized Agent: