1. Recombinant Proteins
  2. Others
  3. NDRG1 Protein, Human (His)

NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NDRG1 Protein, Human (His) is 394 a.a., with molecular weight of ~50.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NDRG1 is a stress-responsive protein and an important tumor suppressor involved in hormone response and cell growth. It aids in Schwann cell transport, which is essential for the development of myelin in peripheral nerves. NDRG1 Protein, Human (His) is the recombinant human-derived NDRG1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NDRG1 Protein, Human (His) is 394 a.a., with molecular weight of ~50.0 kDa.

Background

NDRG1, a stress-responsive protein, plays a crucial role in hormone responses, cell growth, and differentiation, functioning as a tumor suppressor in various cell types. While necessary for p53/TP53-mediated caspase activation and apoptosis, it alone is not sufficient for these processes. NDRG1 contributes to cell trafficking, particularly in Schwann cells, and is essential for the maintenance and development of the peripheral nerve myelin sheath. Additionally, it is required for the vesicular recycling of CDH1 and TF and may participate in lipid trafficking. Notably, NDRG1 shields cells from spindle disruption damage and functions in the p53/TP53-dependent mitotic spindle checkpoint, regulating microtubule dynamics and preserving euploidy. Its interaction with membrane-bound RAB4A is integral to vesicular recycling of CDH1, further emphasizing its diverse roles in cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q92597 (M1-C394)

Gene ID
Molecular Construction
N-term
6*His
NDRG1 (M1-C394)
Accession # Q92597
C-term
Synonyms
Protein NDRG1; Differentiation-Related Gene 1 Protein; DRG-1; N-myc Downstream-Regulated Gene 1 Protein; Nickel-Specific Induction Protein Cap43; Reducing Agents and Tunicamycin-Responsive Protein; RTP; Rit42; NDRG1; CAP43; DRG1; RTP
AA Sequence

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC

Molecular Weight

Approximately 50.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

NDRG1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NDRG1 Protein, Human (His)
Cat. No.:
HY-P70886
Quantity:
MCE Japan Authorized Agent: