NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc)

The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) is the recombinant NEU2 protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) is 379 a.a., with molecular weight of ~45.8 kDa.

The NEU2 protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. This enzymatic activity contributes to the regulation of cell surface glycoconjugates and cellular interactions. NEU2-mediated desialylation can impact the recognition and function of glycoproteins, influencing processes such as cell adhesion, signaling, and immune responses. The removal of sialic acid by NEU2 is vital for modulating the overall glycan structure and function, with potential implications for various physiological and pathological conditions.

Others

Sf9 insect cells

N-10*His;C-Myc

Q64393 (M1-Q379)

100689301  [NCBI]

MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

Approximately 45.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.