1. Recombinant Proteins
  2. Others
  3. NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc)

NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc)

Cat. No.: HY-P72062
Handling Instructions Technical Support

The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) is the recombinant NEU2 protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) is 379 a.a., with molecular weight of ~45.8 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) is the recombinant NEU2 protein, expressed by Sf9 insect cells , with N-10*His, C-Myc labeled tag. The total length of NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) is 379 a.a., with molecular weight of ~45.8 kDa.

Background

The NEU2 protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. This enzymatic activity contributes to the regulation of cell surface glycoconjugates and cellular interactions. NEU2-mediated desialylation can impact the recognition and function of glycoproteins, influencing processes such as cell adhesion, signaling, and immune responses. The removal of sialic acid by NEU2 is vital for modulating the overall glycan structure and function, with potential implications for various physiological and pathological conditions.

Species

Others

Source

Sf9 insect cells

Tag

N-10*His;C-Myc

Accession

Q64393 (M1-Q379)

Gene ID

100689301  [NCBI]

Molecular Construction
N-term
10*His
NEU2 (M1-Q379)
Accession # Q64393
Myc
C-term
Synonyms
NEU2; Sialidase-2; EC 3.2.1.18; Cytosolic sialidase; N-acetyl-alpha-neuraminidase 2
AA Sequence

MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ

Molecular Weight

Approximately 45.8 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NEU2 Protein, Cricetulus griseus (Baculovirus, His-Myc)
Cat. No.:
HY-P72062
Quantity:
MCE Japan Authorized Agent: