1. Recombinant Proteins
  2. Others
  3. Neuritin Protein, Human (N-His)

Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Neuritin Protein, Human (N-His) is 88 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Neutritin is a key factor in neural development, significantly enhancing neurite growth and branching in hippocampal and cortical cells. In the AMPA receptor (AMPAR) complex, neuronal proteins help form the outer core and regulate the function and properties of these receptors. Neuritin Protein, Human (N-His) is the recombinant human-derived Neuritin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Neuritin Protein, Human (N-His) is 88 a.a., with molecular weight of ~11 kDa.

Background

Neuritin, a key player in neural development, significantly enhances neurite outgrowth and branching in primary hippocampal and cortical cells. Within the AMPA receptor (AMPAR) complex, Neuritin contributes to the outer core, which is part of the intricate architecture that modulates the function and properties of these receptors. The AMPAR complex, consisting of an inner core with pore-forming GluA/GRIA proteins and major auxiliary subunits, involves specific interactions with Neuritin and other components like PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1 in the outer core. This outer core is crucial for fine-tuning the gating, pharmacology, biogenesis, and protein processing of AMPARs. Neuritin's involvement in the complex network of protein-protein interactions highlights its role as a regulatory element in shaping the functional properties of AMPARs and underscores its significance in neuronal connectivity.

Biological Activity

Measured in a cell proliferation assay using rat C6 cells. The ED50 this effect is 17.37 ng/ml, corresponding to a specific activity is 5.76×10^4 units/mg.

  • Measured in a cell proliferation assay using rat C6 cells. The ED50 this effect is 17.37 ng/mL, corresponding to a specific activity is 5.76×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NPD7 (A28-N115)

Gene ID
Molecular Construction
N-term
6*His
Neuritin (A28-N115)
Accession # Q9NPD7
C-term
Synonyms
Neuritin 1; Neuritin; NRN; Nrn1; NRN1_HUMAN; OTTHUMP00000015989; RP3 380B8.2 protein
AA Sequence

AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN

Molecular Weight

Approximately 11 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Neuritin Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuritin Protein, Human (N-His)
Cat. No.:
HY-P71908A
Quantity:
MCE Japan Authorized Agent: