1. Recombinant Proteins
  2. Others
  3. NFKB1 Protein, Human (His)

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NFKB1 Protein, Human (His) is 434 a.a., with molecular weight of 45-55 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of NFKB1 Protein, Human (His) is 434 a.a., with molecular weight of 45-55 kDa.

Background

NFKB1 protein serves as a pivotal component of the pleiotropic transcription factor NF-kappa-B, found ubiquitously across various cell types. This transcription factor acts as a central mediator in signal transduction pathways associated with diverse biological processes, including inflammation, immunity, differentiation, cell growth, tumorigenesis, and apoptosis. NFKB1 participates in homo- or heterodimeric complexes, with the p65-p50 heterodimer being the most prevalent. These dimers selectively bind to kappa-B sites in target gene DNA, exhibiting distinct preferences and affinities. NF-kappa-B regulation involves intricate post-translational modifications, subcellular compartmentalization, and interactions with cofactors or corepressors. In an inactive state, NF-kappa-B complexes associate with NF-kappa-B inhibitor (I-kappa-B) family members in the cytoplasm. Activation ensues through phosphorylation and degradation of I-kappa-B, liberating active NF-kappa-B complexes for nuclear translocation. NFKB1 exhibits dual functions, contributing to cytoplasmic retention of NF-kappa-B proteins and generating the active p50 subunit through cotranslational processing. This processing, mediated by the proteasome, ensures the independent functionality of p50 and p105. The p50 subunit binds to kappa-B consensus sequences in the enhancer regions of genes involved in immune response and acute phase reactions. Additionally, NFKB1, in association with MAP3K8, represses MAP3K8-induced MAPK signaling, with active MAP3K8 released through proteasome-dependent degradation of NFKB1/p105.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P19838-2 (M1-G434)

Gene ID
Molecular Construction
N-term
6*His
NFKB1 (M1-G434)
Accession # P19838-2
C-term
Synonyms
DNA-binding factor KBF1; EBP-1; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
AA Sequence

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

Molecular Weight

45-55 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20 mM GSH, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

NFKB1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NFKB1 Protein, Human (His)
Cat. No.:
HY-P71124
Quantity:
MCE Japan Authorized Agent: